The domain within your query sequence starts at position 83 and ends at position 240; the E-value for the Yip1 domain shown below is 3.8e-12.

LDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGPLAVVLFFSMISLYGQFRVVSWI
ITIWIFGSLTIFLLARVLGGEVAYGQVLGVIGYSLLPLIVIAPILLVVGSFEMVSTLIKL
FGVFWAAYSAASLLVGEEFKTKKPLLIYPIFLLYIYFL

Yip1

 Yip1
PFAM accession number:PF04893
Interpro abstract (IPR006977):

This entry contains proteins belonging to the Yip1 family and represents the Yip1 domain. The Yip1 integral membrane domain contains four transmembrane alpha helices. The domain is characterised by the motifs DLYGP and GY. The Yip1 protein is a Golgi protein involved in vesicular transport that interacts with GTPases [ (PUBMED:9724632) ].

GO component:membrane (GO:0016020)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Yip1