The domain within your query sequence starts at position 19 and ends at position 114; the E-value for the Yippee-Mis18 domain shown below is 4.5e-21.

RTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIY
CENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIK

Yippee-Mis18

Yippee-Mis18
PFAM accession number:PF03226
Interpro abstract (IPR004910):

This domain is found in both Yippee-type proteins and Mis18 kinetochore proteins. Yippee are putative zinc-binding/DNA-binding proteins [(PUBMED:11240639)]. Mis18 are proteins involved in the priming of centromeres for recruiting CENP-A [(PUBMED:17199038), (PUBMED:22264723)]. Mis18-alpha and beta form part of a small complex with Mis18-binding protein. Mis18-alpha is found to interact with DNA de-methylases through a Leu-rich region located at its carboxyl terminus [(PUBMED:22552327)]. This domain includes the CULT domain from proteins such as Cereblon [(PUBMED:25569776)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Yippee-Mis18