The domain within your query sequence starts at position 17 and ends at position 187; the E-value for the YjeF_N domain shown below is 5.1e-31.

ERRFLSASEAAALERELLEEYRFGRQQLVELCGHASAVAVTKAFPLPSLSRKQRTVLVVC
GPEQNGAVGLACARHLRVFEYQPSIFCPARSADALHRDLTTQCEKMDIPFLSFLPAEVRL
IDDAYGLVVDAVLGPGVRLAEAGGHCARALATLKRLSIPLVSLDVPSGWDA

YjeF_N

YjeF_N
PFAM accession number:PF03853
Interpro abstract (IPR004443):

In bacteria or archaea, YjeF N-terminal domains occur either as single proteins or fused with other domains and are commonly associated with enzymes. YjeF N-terminal domains are often fused to a YjeF C-terminal domain. It is a bifunctional enzyme that catalyses the epimerisation of the S- and R-forms of NAD(P)HX and the dehydration of the S-form of NAD(P)HX at the expense of ADP, which is converted to AMP [(PUBMED:21994945)].

Structurally, YjeF N-terminal domains represent a novel version of the Rossmann fold, one of the most common protein folds in nature. The YjeF N-terminal domain is comprised of a three-layer alpha-beta-alpha sandwich with a central beta-sheet surrounded by helices. This domain contains a putative catalytic site [(PUBMED:15257761)].

The YjeF N-terminal domain is homologous to AIBP in mammals and YNL200C in budding yeasts. AIBP and YNL200C are NAD(P)H-hydrate epimerases that catalyses the epimerisation of the S- and R-forms of NAD(P)HX, at the expense of ATP, which is converted to ADP [(PUBMED:21994945)].

Some proteins known to contain a YjeF N-terminal domain are listed below:

  • Escherichia coli hypothetical protein YjeF.
  • Thermotoga maritima hypothetical protein Tm0922.
  • Yeast uncharacterised protein YNL200C.
  • Yeast enhancer of mRNA-decapping protein 3 (EDC3).
  • Vertebrate enhancer of mRNA-decapping protein 3 (EDC3).
  • Mammalian apolipoprotein A-I binding protein (AI-BP).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry YjeF_N