The domain within your query sequence starts at position 17 and ends at position 143; the E-value for the YrbL-PhoP_reg domain shown below is 7.1e-8.

RVYKGRKKYSAQVVALKFIPKLGRSEKELRNLQREIEIMRGLWHPNIVHMLDSFETDKEV
VVVTDYAEGELFQILEDDGKLPEDQVQAIAAQLVSALYYLHSHRILHRDMKPQNILLAKG
GGIKLCD

YrbL-PhoP_reg

YrbL-PhoP_reg
PFAM accession number:PF10707
Interpro abstract (IPR019647):

This entry represents proteins that are activated by the protein PhoP. PhoP controls the expression of a large number of genes that mediate adaptation to low Mg2+ environments and/or virulence in several bacterial species. YbrL is proposed to be acting in a loop activity with PhoP and PrmA analogous to the multi-component loop in Salmonella sp., where the PhoP-dependent PmrD protein activates the regulatory protein PmrA, and the activated PmrA then represses transcription from the PmrD promoter which harbours binding sites for both the PhoP and PmrA proteins. Expression of YrbL is induced in low Mg2+ in a PhoP-dependent fashion and repressed by Fe3+ in a PmrA-dependent manner [ (PUBMED:15703297) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry YrbL-PhoP_reg