The domain within your query sequence starts at position 108 and ends at position 233; the E-value for the ZFYVE21_C domain shown below is 1.1e-56.

EFYDKQLKVLLSGATFLVTFGDSEKPETMVCRLSNNQRCLVLDGDSHREIEIAHVCTVQI
LTEGFTPGAGSTRATGMLLQYTVPGAEAAAQLRLMAGEDASGSKRQAAAWLAAMHKATKL
LYESRD

ZFYVE21_C

ZFYVE21_C
PFAM accession number:PF16696
Interpro abstract (IPR032031):

This is the C-terminal domain of Zinc finger FYVE domain-containing protein 21. It has a PH-like fold and is required for the regulation of focal adhesions and in cell migration [(PUBMED:21768110)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ZFYVE21_C