The domain within your query sequence starts at position 289 and ends at position 374; the E-value for the ZU5 domain shown below is 2.8e-8.

DSNLIGPEGGVLSSTVVSQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPI
VTLEPRRRKFHKPITMTIPVPKASSD

ZU5

ZU5
PFAM accession number:PF00791
Interpro abstract (IPR000906): The ZU5 domain is a domain of 90-110 residues present in zona occludens 1 (ZO-1) protein, in unc5-like netrin receptors and in ankyrins. The ZU5 domain is named after the mouse tight junction protein ZO-1 and the C. elegans uncoordinated protein 5 (unc-5) and related Unc5-like netrin receptors. ZU5 domains are found in eukaryotic proteins that in most cases contain a C-terminal death domain. Other domains which can be found N-terminal to a ZU5 domain are ankyrin repeats; Ig-like and TSP1 repeats; PDZ, SH3 and guanylate kinase; or leucine-rich repeats (LRR) [(PUBMED:9126742), (PUBMED:9126743), (PUBMED:14769797), (PUBMED:15073321)]. The ZU5 domain can function as a spectrin-binding domain in ankyrins [(PUBMED:15262991)], and participates in induction of apoptosis and binding of melanoma-associated antigen D1 (MAGE-D1/NRAGE) in UNC5H1-3 [(PUBMED:12598531)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ZU5