The domain within your query sequence starts at position 20 and ends at position 220; the E-value for the Zeta_toxin domain shown below is 8.3e-8.
LTRTLRLFPLHLMKPLVVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQ YGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTM DGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLESTKPIIDLYEE MGKVKKIDASKSVDEVFGEVV
Zeta_toxin |
---|
PFAM accession number: | PF06414 |
---|---|
Interpro abstract (IPR010488): | This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [ (PUBMED:12571357) ]. It has subsequently been found in a number of other proteins, such as polynucleotide kinase and 2',3'-cyclic-nucleotide 3'-phosphodiesterase. It appears to function as a kinase domain [ (PUBMED:12220496) (PUBMED:21445328) ]. |
GO function: | ATP binding (GO:0005524), kinase activity (GO:0016301) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Zeta_toxin