The domain within your query sequence starts at position 126 and ends at position 198; the E-value for the Zf_RING domain shown below is 2e-41.
PVVNDEMCDVCEVWTAESLFPCRVCTRVFHDGCLRRMGYLQGDSAVEVTEMAHTETGWSC YYCDNLNLLLTEE
Zf_RING |
 |
|---|
| PFAM accession number: | PF16744 |
|---|---|
| Interpro abstract (IPR031946): | This entry represents a zinc finger domain found in the uncharacterised protein from animals KIAA1045. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Zf_RING