The domain within your query sequence starts at position 27 and ends at position 74; the E-value for the Zf_RING domain shown below is 1.4e-24.

PVVNDEMCDVCEVWTAESLFPCRVCTRVFHDGCLRRMGYLQGDSAVED

Zf_RING

 Zf_RING
PFAM accession number:PF16744
Interpro abstract (IPR031946):

This entry represents a zinc finger domain found in the uncharacterised protein from animals KIAA1045.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Zf_RING