The domain within your query sequence starts at position 28 and ends at position 219; the E-value for the Zn_dep_PLPC domain shown below is 9.8e-28.

THVEIGHRALEFLRLQDGRINYKELILEHQDAYQAGTVFPDAFYPSICKRGKYHDVSERT
HWTPFLNASIHYIRENYPLPWEKDTEKLVAFLFGITSHMVADVSWHSLGIEQGFLRTMGA
IDFYNSYSDAHSAGDFGGDVLSQFEFNFNYLSRRWYVPVRDLLRIYDNLYGRKVITKDVL
VDCTYLQFLEMH

Zn_dep_PLPC

Zn_dep_PLPC
PFAM accession number:PF00882
Interpro abstract (IPR029002):

This domain is found in bacterial zinc-dependent phospholipase C and in eukaryotic phosphatidylinositol-glycan-specific phospholipase D.

Bacterial phospholipase C is a zinc-dependent enzyme, binding 3 zinc ions per molecule [(PUBMED:2111259)]. This enzyme catalyses the conversion of phosphatidylcholine and water to 1,2-diacylglycerol and choline phosphate. Phosphatidylinositol-glycan-specific phospholipase D is an extracellular amphiphilic glycoprotein [(PUBMED:1606959), (PUBMED:2017684)]. It hydrolyses the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans, releasing these proteins from the membrane.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Zn_dep_PLPC