The domain within your query sequence starts at position 1 and ends at position 67; the E-value for the Zona_pellucida domain shown below is 5.9e-8.
XICPKDDSVKFYSSKRVHFPIPHAEVDKKRFSFVFKSVFNTSLLFLHCELTLCSRKKGSQ KLPKCVT
Zona_pellucida |
---|
PFAM accession number: | PF00100 |
---|---|
Interpro abstract (IPR001507): | The zona pellucida (ZP) domain is a protein polymerisation module of ~260 amino acid module, which is found at the C terminus of many secreted eukaryotic glycoproteins that play fundamental roles in development, hearing, immunity, and cancer [ (PUBMED:1313375) (PUBMED:12021773) (PUBMED:12878193) (PUBMED:15079052) ]. Proteins containing a ZP domain include:
Most ZP domain proteins are synthesized as precursors with carboxy-terminal transmembrane domains or glycosyl phosphatidylinositol (GPI) anchors [ (PUBMED:12021773) ]. The ZP domain contains eight strictly conserved cysteines, which form disulphide bridges. The disulphide bonds within the ZP domains are divided into two groups, suggesting that the ZP domain consists of two subdomains. In addition to the conserved cysteines, only a few aromatic or hydrophobic amino acids are absolutely invariant, probably as a result of structural rather than functional constraints [ (PUBMED:1313375) (PUBMED:12878193) (PUBMED:15079052) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Zona_pellucida