The domain within your query sequence starts at position 35 and ends at position 250; the E-value for the Zwint domain shown below is 4.4e-85.
QEEAELPAKIMEEFMRNSRKKDKLLCSQLQVVNFLQTFLAQEDTEQSPDALASEDASRQK ATETKEQWKDMKATYMDHVDVIKCALSEALPQVKEAHRKYTELQKAFEQLEAKKRVLEEK LQLAQKQWVLQQKRLQNLTKISAEVKRRRKRALEKLDGSHQELETLKQQAGQEQEKLQRN QSYLQLLCSLQNKLVISEGKAEDKDVKGRALTAKSK
Zwint |
---|
PFAM accession number: | PF15556 |
---|---|
Interpro abstract (IPR029092): | ZW10 interactor (also known as Zwint-1) is part of the MIS12 complex, which is required for kinetochore formation and spindle checkpoint activity [ (PUBMED:15485811) ]. It recruits ZW10 to unattached kinetochores at prometaphase [ (PUBMED:16732327) ]. It is essential for stable binding of a Mad1-Mad2 complex to unattached kinetochores [ (PUBMED:15824131) ]. It can be phosphoryltated by Aurora B (AurB) kinase [ (PUBMED:21775627) ]. |
GO process: | mitotic cell cycle checkpoint (GO:0007093) |
GO component: | kinetochore (GO:0000776) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Zwint