The domain within your query sequence starts at position 35 and ends at position 250; the E-value for the Zwint domain shown below is 4.4e-85.

QEEAELPAKIMEEFMRNSRKKDKLLCSQLQVVNFLQTFLAQEDTEQSPDALASEDASRQK
ATETKEQWKDMKATYMDHVDVIKCALSEALPQVKEAHRKYTELQKAFEQLEAKKRVLEEK
LQLAQKQWVLQQKRLQNLTKISAEVKRRRKRALEKLDGSHQELETLKQQAGQEQEKLQRN
QSYLQLLCSLQNKLVISEGKAEDKDVKGRALTAKSK

Zwint

Zwint
PFAM accession number:PF15556
Interpro abstract (IPR029092):

ZW10 interactor (also known as Zwint-1) is part of the MIS12 complex, which is required for kinetochore formation and spindle checkpoint activity [(PUBMED:15485811)]. It recruits ZW10 to unattached kinetochores at prometaphase [(PUBMED:16732327)]. It is essential for stable binding of a Mad1-Mad2 complex to unattached kinetochores [(PUBMED:15824131)]. It can be phosphoryltated by Aurora B (AurB) kinase [(PUBMED:21775627)].

GO process:mitotic cell cycle checkpoint (GO:0007093)
GO component:kinetochore (GO:0000776)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Zwint