The domain within your query sequence starts at position 700 and ends at position 788; the E-value for the betaPIX_CC domain shown below is 5.1e-41.

RKDSVPQVLLPEEEKLIIEETRSNGQTIIEEKSLVDTVYALKDEVKELKQENKKMKQCLE
EELKSRKDLEKLVRKLLKQTDECIRSESS

betaPIX_CC

betaPIX_CC
PFAM accession number:PF16523
Interpro abstract (IPR032409):

This entry represents a C-terminal coiled-coil region found in a group of Rho guanine nucleotide exchange factors (GEFs), including betaPIX [ (PUBMED:20117114) ]. This domain is upstream of the PDZ binding motif and is important for the multimerization of betaPIX [ (PUBMED:20117114) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry betaPIX_CC