The domain within your query sequence starts at position 41 and ends at position 229; the E-value for the cobW domain shown below is 7.1e-51.

PVTIVTGYLGAGKTTLLNYILTEQHNRKIAVILNEFGEGSAVEKSLAVSQGGELYEEWLE
LRNGCLCCSVKDSGLRAIENLMQKKGKFDYILLETTGLADPGAVASMFWVDAELGSDIYL
DGIITVVDSKYGLKHLTEEKPDGLVNEATRQVALADMILINKTDLVSEEELNNLRTTIRS
INGLGKVLE

cobW

cobW
PFAM accession number:PF02492
Interpro abstract (IPR003495):

This domain is found in HypB, a hydrogenase expression/formation protein, and urease accessory protein UreG. Both these proteins contain a P-loop nucleotide binding motif [(PUBMED:9209019), (PUBMED:8423137)]. HypB has GTPase activity and is a guanine nucleotide binding protein [(PUBMED:8423137)]. UreG is a GTPase in charge of nucleotide hydrolysis required for activation of the urease enzyme [(PUBMED:25846143)]. Both GTPases are involved in nickel binding. HypB can store nickel and is required for nickel dependent hydrogenase expression [(PUBMED:9140970)]. UreG is required for functional incorporation of the urease nickel metallocentre [(PUBMED:1624427)]. GTP hydrolysis may required by these proteins for nickel incorporation into other nickel proteins [(PUBMED:9140970)].

Other proteins containing this domain include P47K (P31521), a Pseudomonas chlororaphis protein needed for nitrile hydratase expression, CobW (P29937), which may be involved in cobalamin biosynthesis in Pseudomonas denitrificans [(PUBMED:1655697)], and YjiA [(PUBMED:14696199)]. Both CobW and YjiA are members of the metal homeostasis-associated COG0523 family of GTPases [(PUBMED:24449932)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry cobW