The domain within your query sequence starts at position 9 and ends at position 142; the E-value for the cwf18 domain shown below is 1e-36.
GRLEEEALRRKERLKALREKTGRKASVVAVAVSLGIADLWDPADSSGLGLRLRNYVPEDE DLKRRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKL EKRTQRAIAELIRE
cwf18 |
---|
PFAM accession number: | PF08315 |
---|---|
Interpro abstract (IPR013169): | The cwf18 family is involved in mRNA splicing. It has been isolated as a subcomplex of the splicosome in Schizosaccharomyces pombe (Fission yeast) [ (PUBMED:11884590) ]. This entry also includes Ccdc12 from animals and RXLR100 from Plasmopara viticola [ (PUBMED:29706971) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry cwf18