The domain within your query sequence starts at position 58 and ends at position 102; the E-value for the cwf21 domain shown below is 1.5e-13.
LDHERKRRVELRCLELEEMMEEQGYEEQQIQEKVATFRLMLLEKD
cwf21 |
![]() |
---|
PFAM accession number: | PF08312 |
---|---|
Interpro abstract (IPR013170): | The cwf21 domain is found in proteins involved in mRNA splicing. Proteins containing this domain have been isolated as a subcomplex of the splicosome in Schizosaccharomyces pombe (Fission yeast) [ (PUBMED:11884590) ]. In yeast, this domain binds the protein Prp8p [ (PUBMED:19854871) ], a large and highly conserved U5 snRNP protein which has been proposed as a protein cofactor at the spliceosomal catalytic centre [ (PUBMED:11017191) ]. The cwf21 domain is found in, amongst others, the small Cwc21p protein in yeast as well as in the much larger human ortholog SRm300 (serine/arginine repetitive matrix protein). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry cwf21