The domain within your query sequence starts at position 2 and ends at position 92; the E-value for the dCMP_cyt_deam_2 domain shown below is 3.3e-12.

AQERPSCAVEPEHVQRLLLSSREAKKSAYCPYSRFPVGAALLTGDGRIFSGCNIENACYP
LGVCAERTAIQKAISEGYKDFRAIAISSDLQ

dCMP_cyt_deam_2

dCMP_cyt_deam_2
PFAM accession number:PF08211
Interpro abstract (IPR013171):

This region contains the zinc-binding domain of cytidine and deoxycytidylate deaminase.

Cytidine deaminase (EC 3.5.4.5) (cytidine aminohydrolase) catalyzes the hydrolysis of cytidine into uridine and ammonia while deoxycytidylate deaminase (EC 3.5.4.12) (dCMP deaminase) hydrolyzes dCMP into dUMP. Both enzymes are known to bind zinc and to require it for their catalytic activity [(PUBMED:1567863), (PUBMED:8428902)]. These two enzymes do not share any sequence similarity with the exception of a region that contains three conserved histidine and cysteine residues which are thought to be involved in the binding of the catalytic zinc ion.

GO process:cytidine deamination (GO:0009972)
GO function:cytidine deaminase activity (GO:0004126), zinc ion binding (GO:0008270)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry dCMP_cyt_deam_2