The domain within your query sequence starts at position 29 and ends at position 703; the E-value for the eIF-3c_N domain shown below is 9.6e-267.

GNYGKQPLLLSEDEEDTKRVVRSAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGK
AYGKAKSIVDKEGVPRFYIRILADLEDYLNELWEDKEGKKKMNKNNAKALSTLRQKIRKY
NRDFESHITNYKQNPEQSADEDAEKNEEDSEGSSDEDEDEDGVGNTTFLKKKQESSGESR
KFHKKMEDDDEDSEDSEDEEWDTSSTSSDSDSEEEEGKQTVLASKFLKKAPTTEEDKKAA
EKKREDKAKKKHDRKSKRLDEEEEDNEGGEWERVRGGVPLVKEKPKMFAKGTEITHAVVI
KKLNEILQVRGKKGTDRATQIELLQLLVQIAAENNLGVGVIVKIKFNIIASLYDYNPNLA
TYMKPEMWQMCLDCINELMDTLVAHSNIFVGENILEESENLHNFDQPLRVRGCILTLVER
MDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKGTTEEICQIYLRRILHT
YYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAIL
CHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAH
NALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSA
MLLEIPYMAAHESDA

eIF-3c_N

eIF-3c_N
PFAM accession number:PF05470
Interpro abstract (IPR008905): The largest of the mammalian translation initiation factors, eIF3, consists of at least eight subunits ranging in mass from 35 to 170 kDa. eIF3 binds to the 40 S ribosome in an early step of translation initiation and promotes the binding of methionyl-tRNAi and mRNA [(PUBMED:8995409)]. The N-terminal domain of eukaryotic translation initiation factor 3 subunit C mediates eIF3 binding to eIF1 and eIF5 [(PUBMED:22718758)].
GO process:translational initiation (GO:0006413)
GO component:eukaryotic translation initiation factor 3 complex (GO:0005852)
GO function:translation initiation factor binding (GO:0031369), translation initiation factor activity (GO:0003743)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry eIF-3c_N