SMART: Pfam domain eIF2

The domain within your query sequence starts at position 369 and ends at position 459; the E-value for the eIF2_C domain shown below is 1.4e-39.

TELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIV
LTNPVCTEVGEKIALSRRVEKHWRLIGWGQI

eIF2_C

PFAM accession number:	PF09173
Interpro abstract (IPR015256):	This domain has a beta barrel structure with Greek key topology. It is required for formation of the ternary complex with GTP and initiator tRNA [ (PUBMED:11927566) ]. This entry represents the C-terminal domain of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea. eIF2 is a G protein that delivers the methionyl initiator tRNA to the small ribosomal subunit and releases it upon GTP hydrolysis after the recognition of the initiation codon. eIF2 is composed three subunits, alpha, beta and gamma. Subunit gamma shows strongest conservation, and it confers both tRNA binding and GTP/GDP binding [ (PUBMED:11927566) (PUBMED:23291527) ].

PFAM accession number:

PF09173

Interpro abstract (IPR015256):

This domain has a beta barrel structure with Greek key topology. It is required for formation of the ternary complex with GTP and initiator tRNA [ (PUBMED:11927566) ].

This entry represents the C-terminal domain of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea. eIF2 is a G protein that delivers the methionyl initiator tRNA to the small ribosomal subunit and releases it upon GTP hydrolysis after the recognition of the initiation codon. eIF2 is composed three subunits, alpha, beta and gamma. Subunit gamma shows strongest conservation, and it confers both tRNA binding and GTP/GDP binding [ (PUBMED:11927566) (PUBMED:23291527) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry eIF2_C