The domain within your query sequence starts at position 14 and ends at position 261; the E-value for the eIF3_subunit domain shown below is 7.5e-66.

SDSWDADTFSMEDPVRKVAGGGTAGGDRWEGEDEDEDVKDNWDDDDDENKEEAEVKPEVK
ISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEESKVLTPEEQLADKLRLKKLQEESDLE
LAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEALVRDVCIS
LEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYEGGY
VQDYEDFM

eIF3_subunit

eIF3_subunit
PFAM accession number:PF08597
Interpro abstract (IPR013906):

This shows protein subunits of the eukaryotic translation initiation factor 3 J (eIF3j). It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome [(PUBMED:14688252), (PUBMED:8995409)]. In Saccharomyces cerevisiae, eIF3j has been shown to be required for processing of 20S pre-rRNA and binds to 18S rRNA and eIF3 subunits Rpg1p and Prt1p [(PUBMED:11387228)].

GO component:cytoplasm (GO:0005737), eukaryotic translation initiation factor 3 complex (GO:0005852)
GO function:translation initiation factor activity (GO:0003743)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry eIF3_subunit