The domain within your query sequence starts at position 16 and ends at position 263; the E-value for the eIF3_subunit domain shown below is 7.7e-66.
SDSWDADTFSMEDPVRKVAGGGTAGGDRWEGEDEDEDVKDNWDDDDDENKEEAEVKPEVK ISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEESKVLTPEEQLADKLRLKKLQEESDLE LAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEALVRDVCIS LEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYEGGY VQDYEDFM
eIF3_subunit |
---|
PFAM accession number: | PF08597 |
---|---|
Interpro abstract (IPR013906): | This shows protein subunits of the eukaryotic translation initiation factor 3 J (eIF3j). It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome [ (PUBMED:14688252) (PUBMED:8995409) ]. In Saccharomyces cerevisiae, eIF3j has been shown to be required for processing of 20S pre-rRNA and binds to 18S rRNA and eIF3 subunits Rpg1p and Prt1p [ (PUBMED:11387228) ]. |
GO component: | cytoplasm (GO:0005737), eukaryotic translation initiation factor 3 complex (GO:0005852) |
GO function: | translation initiation factor activity (GO:0003743) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry eIF3_subunit