The domain within your query sequence starts at position 74 and ends at position 184; the E-value for the ecTbetaR2 domain shown below is 4.6e-45.
QLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNITLETVCHDPKLTY HGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTTSSPD
ecTbetaR2 |
---|
PFAM accession number: | PF08917 |
---|---|
Interpro abstract (IPR015013): | The Transforming growth factor beta receptor 2 ectodomain is a compact fold consisting of nine beta-strands and a single helix stabilised by a network of six intra strand disulphide bonds. The folding topology includes a central five-stranded antiparallel beta-sheet, eight-residues long at its centre, covered by a second layer consisting of two segments of two-stranded antiparallel beta-sheets (beta1-beta4, beta3-beta9) [ (PUBMED:11850637) ]. |
GO process: | protein phosphorylation (GO:0006468) |
GO component: | membrane (GO:0016020) |
GO function: | transforming growth factor beta receptor activity, type II (GO:0005026), ATP binding (GO:0005524), metal ion binding (GO:0046872) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ecTbetaR2