The domain within your query sequence starts at position 120 and ends at position 550; the E-value for the hDGE_amylase domain shown below is 7.8e-164.

HVLPLDCVTLQTFLAKCLGPFDEWESRLRVAKESGYNMIHFTPLQTLGLSRSCYSLADQL
ELNPDFSRPSKRYTWSDVGQLVEKLKREWNILCITDVVYNHTATNSKWILEHPESAYNLV
NSPHLKPAWVLDRALWHFSCDVADGKYREKGVPALIENDQHMNCIRKIIWEDIFPRIQLW
EFFQVDVHKAVEQFRRLLSQENRRVTKSEPKEHLKIIQDPEYRRRGCAVDMDTALATFIP
HDNGPAAIEECCNWFRKRLEELNSEKHHLTSCHQEQAVNCLLGNVFYERLAGHGPKLGPV
TRKYPLVTRYFTFPFGEMALSAEEALIHLPDKACFLMAHNGWVMGDDPLRNFAEPGSDVY
LRRELICWGDSVKLRYGNKPEDCPYLWAHMKKYTEITATHFQGVRLDNCHSTPLHVAEYM
LDAARKLQPNL

hDGE_amylase

hDGE_amylase
PFAM accession number:PF14701
Interpro abstract (IPR032792): This is a glucanotransferase catalytic domain of the glycogen debranching enzyme AGL. AGL is a multifunctional enzyme acting as 1,4-alpha-D-glucan:1,4-alpha-D-glucan 4-alpha-D-glycosyltransferase and amylo-1,6-glucosidase in glycogen degradation [(PUBMED:21585652)]. This glucanotransferase domain is predicted to have a structure of a 8 stranded alpha/beta barrel (TIM barrel) where strands are interrupted by long loops and additional mini-domains.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry hDGE_amylase