SMART: Pfam domain hNIFK

The domain within your query sequence starts at position 250 and ends at position 288; the E-value for the hNIFK_binding domain shown below is 4.8e-26.

SVDSQGPTPVCTPTFLERRKSQVMEVGGDKDDEIILKLP

hNIFK_binding

PFAM accession number:	PF12196
Interpro abstract (IPR021043):	This entry represents eukaryotic proteins that contain a domain of approximately 40 amino acids in length. These proteins are found in association with . There are two conserved sequence motifs: TPVCTP and LERRKS. This domain is found on the human nucleolar protein hNIFK. It binds to the fork-head-associated domain of human Ki67. High-affinity binding requires sequential phosphorylation by two kinases, CDK1 and GSK3, yielding pThr238, pThr234 and pSer230. This interaction is involved in cell cycle regulation [ (PUBMED:16244663) ].

PFAM accession number:

PF12196

Interpro abstract (IPR021043):

This entry represents eukaryotic proteins that contain a domain of approximately 40 amino acids in length. These proteins are found in association with . There are two conserved sequence motifs: TPVCTP and LERRKS. This domain is found on the human nucleolar protein hNIFK. It binds to the fork-head-associated domain of human Ki67. High-affinity binding requires sequential phosphorylation by two kinases, CDK1 and GSK3, yielding pThr238, pThr234 and pSer230. This interaction is involved in cell cycle regulation [ (PUBMED:16244663) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry hNIFK_binding