The domain within your query sequence starts at position 69 and ends at position 176; the E-value for the hSac2 domain shown below is 1.8e-31.

KYFVTRPGAIETAVEDLKGHIAQTSGETVQGFWLLTEIDHWNNEKEKILLLTDKTLLICK
YDFIMLSCVQVQQVPLNAICCICLGKFVFPGMSLDKRPGDGLRIFWGS

hSac2

hSac2
PFAM accession number:PF12456
Interpro abstract (IPR022158):

This domain is found in eukaryotes, and is approximately 120 amino acids in length. It is often found in association with . It is found in hSac2, which functions as an inositol polyphosphate 5-phosphatase.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry hSac2