The domain within your query sequence starts at position 463 and ends at position 550; the E-value for the mRNA_cap_C domain shown below is 3.7e-28.

SLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIKVTKELKQYDNKIIECKFENN
SWVFMRQRIDKSFPNAYNTAMDVQQPPR

mRNA_cap_C

mRNA_cap_C
PFAM accession number:PF03919
Interpro abstract (IPR013846):

This domain is found at the C terminus of the mRNA capping enzyme. The mRNA capping enzyme in yeasts is composed of two separate chains: alpha a mRNA guanyltransferase and beta an RNA 5'-triphosphate. X-ray crystallography reveals a large conformational change during guanyl transfer by mRNA capping enzymes [ (PUBMED:9160746) ]. Binding of the enzyme to nucleotides is specific to the GMP moiety of GTP. The viral mRNA capping enzyme is a monomer that transfers a GMP cap onto the end of mRNA that terminates with a 5'-diphosphate tail.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry mRNA_cap_C