The domain within your query sequence starts at position 536 and ends at position 578; the E-value for the mRNA_decap_C domain shown below is 2.1e-20.
SRPLTRLQLQEALLNLIQNDDNFLSIIYEAYLFSVTQAAMRTT
mRNA_decap_C |
 |
|---|
| PFAM accession number: | PF16741 |
|---|---|
| Interpro abstract (IPR031953): | This entry represents the C-terminal domain of animal mRNA-decapping enzyme DCP1 that is responsible for its trimerisation. DCP1 trimerisation is required for its incorporation into active decapping complexes and for efficient mRNA decapping in vivo. The structure of this domain has been revealed [ (PUBMED:19966221) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry mRNA_decap_C