The domain within your query sequence starts at position 2 and ends at position 67; the E-value for the mTERF domain shown below is 2.2e-11.
VKENMKVYHLELGFKHNEIQHMVIKIPKMLTANKRKLTEIFDYVHNVMNIPHHIIVKFPQ TSWWPL
mTERF |
 |
|---|
| PFAM accession number: | PF02536 |
|---|---|
| Interpro abstract (IPR003690): | This entry represents the mitochondrial/chloroplastic transcription termination factors (MTERFs). In humans four MTERFs have been identified (MTERF1-4). MTERF1 was first identified as a factor responsible for terminating heavy strand transcription at a specific site at the leu-tRNA, thereby modulating the ratio of mitochondrial ribosomal RNA to mRNA [ (PUBMED:2752429) ]. Later, MTERF1 was found to stimulate transcriptional initiation [ (PUBMED:19366610) ] and appeared to be in the control of mitochondrial replication pausing [ (PUBMED:17884915) ]. From a structural study, it binds to dsDNA containing the termination sequence and unwinds the DNA molecule, promoting base eversion, which is critical for transcription termination [ (PUBMED:20550934) ]. |
| GO process: | regulation of transcription, DNA-templated (GO:0006355) |
| GO function: | double-stranded DNA binding (GO:0003690) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry mTERF