The domain within your query sequence starts at position 558 and ends at position 825; the E-value for the muHD domain shown below is 1.7e-74.

LPVAAAFTETVNAYFKGADPSKCIVKITGEMVLSFPAGITRHFANNPSPAALTFRVVNSS
RLEHVLPNPQLLCCDNTQNDANTKEFWVNMPNLMTHLKKVSEQKPQATYYNVDMLKYQVS
AQGIQSTPLNLAVNWRCEPASTDLRIDYKYNTDAMSTAVALNNVQFLVPIDGGVTKLQAV
LPPAVWNAEQQRILWKIPDISQKSENGGVGSLLARFQLSEGPSKPSPLVVQFTSEGSTLS
GCDIELVGAGYRFSLIKKRFAAGKYLAD

muHD

muHD
PFAM accession number:PF10291
Interpro abstract (IPR018808):

The muniscins are a family of endocytic adaptors that is conserved from yeast to humans.This C-terminal domain is structurally similar to mu homology domains, and is the region of the muniscin proteins involved in the interactions with the endocytic adaptor-scaffold proteins Ede1-eps15. This interaction influences muniscin localisation. The muniscins provide a combined adaptor-membrane-tubulation activity that is important for regulating endocytosis [(PUBMED:19713939)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry muHD