The domain within your query sequence starts at position 315 and ends at position 369; the E-value for the nlz1 domain shown below is 3.6e-24.

SSIGYHGSIVGAYAGYPSQFVPGLDPSKSGLVGGQLSGGLGLPPGKPPSSSPLTG

nlz1

nlz1
PFAM accession number:PF12402
Interpro abstract (IPR022129):

This domain family is found in eukaryotes, and is typically between 42 and 57 amino acids in length. There is a conserved GAY sequence motif. There is a single completely conserved residue G that may be functionally important. Nlz1 self-associated via its C terminus, interacted with Nlz2, and bound to histone deacetylases. These proteins may function as a transcriptional repressors [(PUBMED:14550789)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry nlz1