The domain within your query sequence starts at position 51 and ends at position 212; the E-value for the p25-alpha domain shown below is 3.7e-73.

EEAFRRFAVHGDTRATGKEMHGKNWSKLCKDCHVIDGKNVTVTDVDIVFSKIKGKSCRTI
TFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGRAPVISGVTKAVSSPTVSRLTDTSK
FTGSHKERFDQSGKGKGKAGRVDLVDESGYVPGYKHAGTYDQ

p25-alpha

p25-alpha
PFAM accession number:PF05517
Interpro abstract (IPR008907): This family includes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [(PUBMED:1909972)]. In mammals, the protein appears to be brain specific.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry p25-alpha