The domain within your query sequence starts at position 332 and ends at position 403; the E-value for the p47_phox_C domain shown below is 1.3e-22.

FLQQRRRPGRPGPLSTDGTKGERQGGPGPGLEGRDNPSTPRVKPQPAVPPRPSSDLILHR
CTESTKRKLTSA

p47_phox_C

p47_phox_C
PFAM accession number:PF08944
Interpro abstract (IPR015039):

The C-terminal domain of the phagocyte NADPH oxidase subunit p47Phox contains conserved PxxP motifs that allow binding to SH3 domains, with subsequent activation of the NADPH oxidase, and generation of superoxide, which plays a crucial role in host defence against microbial infection [(PUBMED:12169629)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry p47_phox_C