The domain within your query sequence starts at position 10 and ends at position 188; the E-value for the p53-inducible11 domain shown below is 8.5e-102.

MKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFAVREPLGLRVWQFLS
AMLFSSVAIMALALPDQLYDAVFDGAEVTSKTPIRLYGGALLSISLIMWNALYTAEKVII
RWTLLTEACYFGVQSLVVTATLAETGLMSLGTVLLLASRLLFVIVSIYYYYQVGRKPKK

p53-inducible11

p53-inducible11
PFAM accession number:PF14936
Interpro abstract (IPR028266):

p53 is a tumour suppressor that suppresses tumour development by inducing stable growth arrest or cell apoptosis [ (PUBMED:9305847) ]. The expression of p53 induces the transcription of several genes, including the TP53I11 (also known as PIG11) gene, which expresses the tumor protein p53-inducible protein 11 [ (PUBMED:9305847) ]. The function of this protein is not clear.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry p53-inducible11