The domain within your query sequence starts at position 99 and ends at position 141; the E-value for the pKID domain shown below is 5.3e-24.

ESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEK

pKID

pKID
PFAM accession number:PF02173
Interpro abstract (IPR003102): The nuclear factor CREB activates transcription of target genes in part through direct interactions with the KIX domain of the coactivator CBP in a phosphorylation-dependent manner. CBP and P300 bind to the pKID (phosphorylated kinase-inducible-domain) domain of CREB [(PUBMED:9413984)].
GO process:regulation of transcription, DNA-templated (GO:0006355)
GO function:protein binding (GO:0005515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry pKID