The domain within your query sequence starts at position 111 and ends at position 334; the E-value for the polyprenyl_synt domain shown below is 3.2e-55.

RLKEVLEYNALGGKYNRGLTVVQAFQELVEPKKQDAESLQRALTVGWCVELLQAFFLVSD
DIMDSSLTRRGQICWYQKPGIGLDAINDALLLEASIYRLLKFYCREQPYYLNLLELFLQS
SYQTEIGQTLDLMTAPQGHVDLGRYTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEK
EHANALKILMEMGEFFQVQENYGQKDPEKVARVKALYEALDLQS

polyprenyl_synt

polyprenyl_synt
PFAM accession number:PF00348
Interpro abstract (IPR000092): A variety of isoprenoid compounds are synthesized by various organisms. For example in eukaryotes the isoprenoid biosynthetic pathway is responsible for the synthesis of a variety of end products including cholesterol, dolichol, ubiquinone or coenzyme Q. In bacteria this pathway leads to the synthesis of isopentenyl tRNA, isoprenoid quinones, and sugar carrier lipids. Among the enzymes that participate in that pathway, are a number of polyprenyl synthetase enzymes which catalyze a 1'4-condensation between 5 carbon isoprene units. It has been shown [(PUBMED:2198286), (PUBMED:2089044), (PUBMED:1826006), (PUBMED:1303794), (PUBMED:1495965)] that these enzymes share some regions of sequence similarity.
GO process:isoprenoid biosynthetic process (GO:0008299)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry polyprenyl_synt