The domain within your query sequence starts at position 580 and ends at position 839; the E-value for the rRNA_proc-arch domain shown below is 1.7e-91.

EYMLEKSFYQFQHYRAIPGVVEKVKNSEEQYNKIVIPNEENVVIYYKIRQQLAKLGKEIE
EYIHKPKYCLPFLQPGRLVKVKNEGDDFGWGVVVNFSKKSNVKPNSGELDPLYVVEVLLR
CSKESLKNSATEAAKPAKPDEKGEMQVVPVLVHLLSAISTVRLYIPKDLRPVDNRQSVLK
SIQEVQRRFPDGVPLLDPIDDMGIQDQGLKKVIQKVEAFEHRMYSHPLHNDPNLETVYTL
CERKAQIALDIKSAKRELKK

rRNA_proc-arch

rRNA_proc-arch
PFAM accession number:PF13234
Interpro abstract (IPR025696):

The essential RNA helicase Mtr4 is an exosome-activating cofactor. This arch domain can be found in Mtr4 and Ski2 (the cytosolic homologue of Mtr4). The arch domain is required for proper 5.8S rRNA processing, and appears to function independently of canonical helicase activity [(PUBMED:20512111)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry rRNA_proc-arch