The domain within your query sequence starts at position 48 and ends at position 239; the E-value for the rRNA_processing domain shown below is 2.5e-12.

SVRKGQGFAFRRKLKIQQNYKKLLWKVKEAPASQESQFTDRYPEHLKHLYLAEEERLRKQ
QRKAGLALSEEQVDRPLPEEEGSTEQTSSEEPPGGHQPQPEELNTGSSVTFPKNKKKKTS
NQKAQEEYERVQAKRAAKKFEFEMRKQEREEAQRLYKKKKMEAFKILSKKTKKGQPNLNL
QMEYLLQKIQEN

rRNA_processing

• PFAM accession number: PF08524
• Interpro abstract (IPR013730):

  This entry include proteins from the FYV7 and the TAP26 families [ (PUBMED:12837249) ].

  FYV7 is involved in the processing of 20S pre-rRNA during the maturation of SSU-rRNA from tricistronic RNA transcripts (SSU-rRNA, 5.8S rRNA, LSU-rRNA). The SSU (small subunit) processome is required for production of the small ribosomal subunit RNA, the 18S rRNA [ (PUBMED:12242301) ]. Fyv7 may also be required for survival upon K1 Killer toxin exposure.

  Thyroid transcription factor 1-associated protein 26 (TAP26, also known as BR22) is a component of the transcription complexes of the pulmonary surfactant-associated protein-B (SFTPB) and -C (SFTPC). It enhances homeobox protein Nkx-2.1-activated SFTPB and SFTPC promoter activities [ (PUBMED:12882447) (PUBMED:16630564) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry rRNA_processing