The domain within your query sequence starts at position 32 and ends at position 94; the E-value for the stn_TNFRSF12A domain shown below is 1.1e-33.
GAAAPPAHFRLLWPILGGALSLVLVLALVSSFLVWRRCRRREKFTTPIEETGGEGCPGVA LIQ
stn_TNFRSF12A |
 |
|---|
| PFAM accession number: | PF12191 |
|---|---|
| Interpro abstract (IPR022316): | The tumour necrosis factor (TNF) receptor (TNFR) superfamily comprises more than 20 type-I transmembrane proteins. Family members are defined based on similarity in their extracellular domain - a region that contains many cysteine residues arranged in a specific repetitive pattern [ (PUBMED:7917108) ]. The cysteines allow formation of an extended rod-like structure, responsible for ligand binding [ (PUBMED:8387891) ]. Upon receptor activation, different intracellular signalling complexes are assembled for different members of the TNFR superfamily, depending on their intracellular domains and sequences [ (PUBMED:15500863) ]. Activation of TNFRs can therefore induce a range of disparate effects, including cell proliferation, differentiation, survival, or apoptotic cell death, depending upon the receptor involved [ (PUBMED:11239407) ]. TNFRs are widely distributed and play important roles in many crucial biological processes, such as lymphoid and neuronal development, innate and adaptive immunity, and maintenance of cellular homeostasis [ (PUBMED:15500863) ]. Drugs that manipulate their signalling have potential roles in the prevention and treatment of many diseases, such as viral infections, coronary heart disease, transplant rejection, and immune disease [ (PUBMED:9826574) ]. TNF receptor 12, also known as TWEAK receptor (TWEAKR), fibroblast growth factor-inducible-14 (Fn14) or CD266, is expressed on a wide variety of different cell types and binds the ligand TWEAK (tumor necrosis factor-like weak inducer of apoptosis) to activate several signaling cascades through activation of NF-kappaB signaling mediated by adaptor TRAF proteins [ (PUBMED:18404150) ]. The FN14/TWEAK pathway controls a range of cellular activities such as proliferation, differentiation, and apoptosis, and has diverse biological functions in pathological mechanisms like inflammation and fibrosis that are associated with cardiovascular diseases (CVDs) [ (PUBMED:24478772) ]. The Fn14 receptor is the smallest TNFR superfamily member described so far. It is initially synthesized as a 129-amino-acid type I transmembrane protein that is then proteolytically processed by signal peptidase. The mature form of TweakR has only 102 amino acids and six cysteine residues in its extracellular region [ (PUBMED:11728344) (PUBMED:18404150) ]. |
| GO process: | positive regulation of apoptotic process (GO:0043065) |
| GO component: | plasma membrane (GO:0005886) |
| GO function: | protein binding (GO:0005515) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry stn_TNFRSF12A