The domain within your query sequence starts at position 1054 and ends at position 1380; the E-value for the tRNA-synt_His domain shown below is 5.7e-18.

NFLIRTAKIQQLVCETIVRVFKRHGAVQLCTPLLLPRNRQIYEHNEAALFMDHSGMLVML
PFDLRVPFARYVARNNILNLKRYCIERVFRPRKLDRFHPKELLECAFDIVTSTTNSSLPT
AETIYTIYEIIQEFPALQERNYSIYLNHTMLLKAILLHCGIPEDKLSQVYVILYDAVTEK
LTRREVEAKFCNLSLSSNSLCRLYKFIEQKGDLQDLTPTINSLIKQKTGVAQLVKYSLKD
LEDVVGLLKKLGVKLQVSINLGLVYKVQQHTGIIFQFLAFSKRRQRVVPEILAAGGRYDL
LIPKFRGPQTVGPVPTAVGVSIAIDKI

tRNA-synt_His

tRNA-synt_His
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry tRNA-synt_His