The domain within your query sequence starts at position 61 and ends at position 313; the E-value for the tRNA-synt_His domain shown below is 1.3e-23.

GTRDLSPQQMVVREKILDKIISCFKRHGAKGLDTPAFELKEMLTEKYEDNFGLMYDLKDQ
GGELLSLRYDLTVPFARYLAMNKLKKMKRYQVGKVWRRESPAIAQGRYREFCQCDFDIAG
EFDPMIPDAECLRIMCEILSGLQLGDFLIKVNDRRVVDGIFAVCGVPESKLRTICSSMDK
LDKMSWEGVRHEMVAKKGLAPEVADRIGDFVQYHGGISLVEDLFKDPRLSQSQLALQGLG
DLKLLFEYLRLFG

tRNA-synt_His

tRNA-synt_His
PFAM accession number:PF13393
Interpro abstract (IPR041715):

HisRS is a homodimer and is responsible for the attachment of histidine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent formation of the enzyme bound aminoacyl-adenylate. Class II assignment is based upon its structure and the presence of three characteristic sequence motifs [ (PUBMED:12269828) ]. This domain is also found at the C terminus of eukaryotic GCN2 protein kinase [ (PUBMED:7623840) ] and at the N terminus of the ATP phosphoribosyltransferase accessory subunit, HisZ. HisZ along with HisG catalyze the first reaction in histidine biosynthesis. HisZ is found only in a subset of bacteria and differs from HisRS in lacking a C-terminal anti-codon binding domain [ (PUBMED:10430882) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry tRNA-synt_His