The domain within your query sequence starts at position 932 and ends at position 1259; the E-value for the tRNA-synt_His domain shown below is 1.1e-18.
GNFLIRTAKIQQLVCETIVRVFKRHGAVQLCTPLLLPRNRQIYEHNEAALFMDHSGMLVM LPFDLRVPFARYVARNNILNLKRYCIERVFRPRKLDRFHPKELLECAFDIVTSTTNSSLP TAETIYTIYEIIQEFPALQERNYSIYLNHTMLLKAILLHCGIPEDKLSQVYVILYDAVTE KLTRREVEAKFCNLSLSSNSLCRLYKFIEQKGDLQDLTPTINSLIKQKTGVAQLVKYSLK DLEDVVGLLKKLGVKLQVSINLGLVYKVQQHTGIIFQFLAFSKRRQRVVPEILAAGGRYD LLIPKFRGPQTVGPVPTAVGVSIAIDKI
tRNA-synt_His |
---|
PFAM accession number: | PF13393 |
---|---|
Interpro abstract (IPR041715): | HisRS is a homodimer and is responsible for the attachment of histidine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent formation of the enzyme bound aminoacyl-adenylate. Class II assignment is based upon its structure and the presence of three characteristic sequence motifs [ (PUBMED:12269828) ]. This domain is also found at the C terminus of eukaryotic GCN2 protein kinase [ (PUBMED:7623840) ] and at the N terminus of the ATP phosphoribosyltransferase accessory subunit, HisZ. HisZ along with HisG catalyze the first reaction in histidine biosynthesis. HisZ is found only in a subset of bacteria and differs from HisRS in lacking a C-terminal anti-codon binding domain [ (PUBMED:10430882) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry tRNA-synt_His