The domain within your query sequence starts at position 941 and ends at position 1268; the E-value for the tRNA-synt_His domain shown below is 4.8e-19.

GNFLIRTAKIQQLVCETIVRVFKRHGAVQLCTPLLLPRNRQIYEHNEAALFMDHSGMLVM
LPFDLRVPFARYVARNNILNLKRYCIERVFRPRKLDRFHPKELLECAFDIVTSTTNSSLP
TAETIYTIYEIIQEFPALQERNYSIYLNHTMLLKAILLHCGIPEDKLSQVYVILYDAVTE
KLTRREVEAKFCNLSLSSNSLCRLYKFIEQKGDLQDLTPTINSLIKQKTGVAQLVKYSLK
DLEDVVGLLKKLGVKLQVSINLGLVYKVQQHTGIIFQFLAFSKRRQRVVPEILAAGGRYD
LLIPKFRGPQTVGPVPTAVGVSIAIDKI

tRNA-synt_His

tRNA-synt_His
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry tRNA-synt_His