The domain within your query sequence starts at position 164 and ends at position 257; the E-value for the tRNA_bind domain shown below is 2.9e-34.
LRIGCIVTAKKHPDADSLYVEEVDVGEAAPRTVVSGLVNHVPLEQMQNRMVVLLCNLKPA KMRGVLSQAMVMCASSPEKVEILAPPNGSVPGDR
tRNA_bind |
---|
PFAM accession number: | PF01588 |
---|---|
Interpro abstract (IPR002547): | This domain is found in prokaryotic methionyl-tRNA synthetases, prokaryotic phenylalanyl tRNA synthetases, the yeast GU4 nucleic-binding protein (G4p1 or p42, ARC1) [ (PUBMED:8895587) ], human tyrosyl-tRNA synthetase [ (PUBMED:9162081) ], endothelial-monocyte activating polypeptide II and export-related chaperon CsaA [ (PUBMED:11157762) ]. G4p1 binds specifically to tRNA form a complex with methionyl-tRNA synthetases [ (PUBMED:8895587) ]. In human tyrosyl-tRNA synthetase, this domain may direct tRNA to the active site of the enzyme [ (PUBMED:8895587) ]. This domain may perform a common function in tRNA aminoacylation [ (PUBMED:9162081) ]. |
GO function: | tRNA binding (GO:0000049) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry tRNA_bind