The domain within your query sequence starts at position 771 and ends at position 892; the E-value for the tRNA_bind_2 domain shown below is 3.6e-46.
FRRRFLALLSYQFSTFSPALSLNIIQNRNVAKSALPALGREHLEALFLPYDLKRLEMYSR NMVDYHLIMDLIPAISRLYFLNQLGDLSLSAAQSALLLGIGLQHKSVDQLEKEIELPSGQ LM
tRNA_bind_2 |
---|
PFAM accession number: | PF13725 |
---|---|
Interpro abstract (IPR027992): | This domain, found at the C terminus of tRNA(Met) cytidine acetyltransferase, may be involved in tRNA-binding [ (PUBMED:19322199) ]. tRNA(Met) cytidine acetyltransferase TmcA catalyses the formation of N(4)-acetylcytidine (ac4C) at the wobble position of tRNA(Met), by using acetyl-CoA as an acetyl donor and ATP (or GTP) [ (PUBMED:18668122) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry tRNA_bind_2