The domain within your query sequence starts at position 771 and ends at position 892; the E-value for the tRNA_bind_2 domain shown below is 3.6e-46.

FRRRFLALLSYQFSTFSPALSLNIIQNRNVAKSALPALGREHLEALFLPYDLKRLEMYSR
NMVDYHLIMDLIPAISRLYFLNQLGDLSLSAAQSALLLGIGLQHKSVDQLEKEIELPSGQ
LM

tRNA_bind_2

tRNA_bind_2
PFAM accession number:PF13725
Interpro abstract (IPR027992):

This domain, found at the C terminus of tRNA(Met) cytidine acetyltransferase, may be involved in tRNA-binding [(PUBMED:19322199)]. tRNA(Met) cytidine acetyltransferase TmcA catalyses the formation of N(4)-acetylcytidine (ac4C) at the wobble position of tRNA(Met), by using acetyl-CoA as an acetyl donor and ATP (or GTP) [(PUBMED:18668122)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry tRNA_bind_2