The domain within your query sequence starts at position 62 and ends at position 132; the E-value for the tRNA_int_end_N2 domain shown below is 1.9e-23.

LWQLLAEERVERLGSLVAAEWKPEEGFVELTSPAGKFWQTMGYSEEGRQRLHPEEALYLL
ECGSIQLFYQD

tRNA_int_end_N2

tRNA_int_end_N2
PFAM accession number:PF12928
Interpro abstract (IPR024336):

tRNA-splicing endonucleases (EC 3.1.27.9) catalyse the endonucleolytic cleavage of pre tRNA at the 5' and 3' splice sites to release the intron and produces two half tRNA molecules bearing 5' hydroxyl and 2', 3'-cyclic phosphate termini [(PUBMED:9321408), (PUBMED:9200603)]. The genes encoding these proteins are homologous in eukaryotes and archea. The eukaryotic tRNA-splicing endonucleases are heterotetrameric while the archaeal endonucleases can be split into homodimeric and homotetrameric subgroups.

This entry represents the N-terminal domain of Sen54, a non-catalytic subunit of the tRNA-splicing endonuclease complex. Defects in human Sen54 are a cause of pontocerebellar hypoplasia type 4 [(PUBMED:18711368)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry tRNA_int_end_N2