The domain within your query sequence starts at position 334 and ends at position 426; the E-value for the tRNA_int_endo domain shown below is 5.2e-21.

FRTTYMAYHYFRSKGWVPKVGLKYGTDLLLYRKGPPFYHASYSVIIELLDDNYEGSLRRP
FSWKSLAALSRVSGNVSKELMLCYLIKPSTMTA

tRNA_int_endo

tRNA_int_endo
PFAM accession number:PF01974
Interpro abstract (IPR006677):

This entry represents a three-layer alpha/beta/alpha domain found as the catalytic domain at the C-terminal in homotetrameric tRNA-intron endonucleases [(PUBMED:9535656)], and as domains 2 and 4 (C-terminal) in the homodimeric enzymes [(PUBMED:16690865)]. tRNA-intron endonucleases (EC 3.1.27.9) remove tRNA introns by cleaving pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-hydroxyl termini [(PUBMED:9200602)]. These enzymes recognise a pseudosymmetric substrate in which two bulged loops of three bases are separated by a stem of four bp [(PUBMED:14993668)]. Although homotetrameric enzymes contain four active sites, only two participate in the cleavage, and should therefore, be considered as a dimer of dimers.

GO process:tRNA splicing, via endonucleolytic cleavage and ligation (GO:0006388)
GO function:tRNA-intron endonuclease activity (GO:0000213)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry tRNA_int_endo