The domain within your query sequence starts at position 258 and ends at position 324; the E-value for the tRNA_int_endo_N domain shown below is 9.9e-16.

CGAQEEEAAAASDEKLLKRKKLVCRRNPYRIFEYLQLSLEEAFFLAYALGCLSIYYEKEP
LTIVKLW

tRNA_int_endo_N

tRNA_int_endo_N
PFAM accession number:PF02778
Interpro abstract (IPR006678):

This entry represents a 2-layer alpha/beta domain found at the N terminus of the homotetrameric tRNA-intron endonucleases [(PUBMED:9535656)], and as domains 1 (N-terminal) and 3 in the homodimeric enzymes [(PUBMED:16690865)]. tRNA-intron endonucleases (EC 3.1.27.9) remove tRNA introns by cleaving pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-hydroxyl termini [(PUBMED:9200602)]. These enzymes recognise a pseudosymmetric substrate in which 2 bulged loops of 3 bases are separated by a stem of 4 bp [(PUBMED:14993668)]. Although homotetrameric enzymes contain four active sites, only two participate in the cleavage, and should therefore, be considered as a dimer of dimers.

GO process:tRNA splicing, via endonucleolytic cleavage and ligation (GO:0006388)
GO function:tRNA-intron endonuclease activity (GO:0000213)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry tRNA_int_endo_N