The domain within your query sequence starts at position 258 and ends at position 324; the E-value for the tRNA_int_endo_N domain shown below is 9.9e-16.
CGAQEEEAAAASDEKLLKRKKLVCRRNPYRIFEYLQLSLEEAFFLAYALGCLSIYYEKEP LTIVKLW
tRNA_int_endo_N |
![]() |
---|
PFAM accession number: | PF02778 |
---|---|
Interpro abstract (IPR006678): | This entry represents a 2-layer alpha/beta domain found at the N terminus of the homotetrameric tRNA-intron endonucleases [ (PUBMED:9535656) ], and as domains 1 (N-terminal) and 3 in the homodimeric enzymes [ (PUBMED:16690865) ]. tRNA-intron endonucleases ( EC 3.1.27.9 ) remove tRNA introns by cleaving pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-hydroxyl termini [ (PUBMED:9200602) ]. These enzymes recognise a pseudosymmetric substrate in which 2 bulged loops of 3 bases are separated by a stem of 4 bp [ (PUBMED:14993668) ]. Although homotetrameric enzymes contain four active sites, only two participate in the cleavage, and should therefore, be considered as a dimer of dimers. |
GO process: | tRNA splicing, via endonucleolytic cleavage and ligation (GO:0006388) |
GO function: | tRNA-intron endonuclease activity (GO:0000213) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry tRNA_int_endo_N