The domain within your query sequence starts at position 135 and ends at position 308; the E-value for the tRNA_m1G_MT domain shown below is 2.6e-46.
TQHMSKKELSRLAGQIRRLYGSNKKASRPFWICLTGFSTASPLYEECLRMNDGFSAYLLD VTEEDCFSLFPLETLVYLTPDSEHSLEDIDQSTVYVIGGLVDESIQKKVTFQKAREYSVK TARLPIQEYMIKRQNEKNYHSEILAINQVFDILSTYFETRNWPEALKKGVSPGK
tRNA_m1G_MT |
---|
PFAM accession number: | PF01746 |
---|---|
Interpro abstract (IPR016009): | This domain is found in tRNA methyltransferases including tRNA (guanine-N(1)-)-methyltransferases (TRMD) and mitochondrial ribonuclease P protein 1. Proteins containing this domain also include tRNA (guanine(9)-N1)-methyltransferase (Trm10) from yeasts. Escherichia coli K12 tRNA (guanine-N(1)-)-methyltransferase catalyses the conversion of a guanosine residue to N1-methylguanine in position 37, next to the anticodon, in tRNA [ (PUBMED:6337136) ]. Mitochondrial RNase P (mtRNase P) functions in mitochondrial tRNA maturation [ (PUBMED:18984158) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry tRNA_m1G_MT