The domain within your query sequence starts at position 135 and ends at position 308; the E-value for the tRNA_m1G_MT domain shown below is 2.6e-46.

TQHMSKKELSRLAGQIRRLYGSNKKASRPFWICLTGFSTASPLYEECLRMNDGFSAYLLD
VTEEDCFSLFPLETLVYLTPDSEHSLEDIDQSTVYVIGGLVDESIQKKVTFQKAREYSVK
TARLPIQEYMIKRQNEKNYHSEILAINQVFDILSTYFETRNWPEALKKGVSPGK

tRNA_m1G_MT

tRNA_m1G_MT
PFAM accession number:PF01746
Interpro abstract (IPR016009):

This domain is found in tRNA methyltransferases including tRNA (guanine-N(1)-)-methyltransferases (TRMD) and mitochondrial ribonuclease P protein 1. Proteins containing this domain also include tRNA (guanine(9)-N1)-methyltransferase (Trm10) from yeasts.

Escherichia coli K12 tRNA (guanine-N(1)-)-methyltransferase catalyses the conversion of a guanosine residue to N1-methylguanine in position 37, next to the anticodon, in tRNA [(PUBMED:6337136)]. Mitochondrial RNase P (mtRNase P) functions in mitochondrial tRNA maturation [(PUBMED:18984158)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry tRNA_m1G_MT