The domain within your query sequence starts at position 5 and ends at position 111; the E-value for the vWA-TerF-like domain shown below is 2.5e-7.
CAGIQGIVDAYRQALPQVRLYGPTNFAPIINHVARFAAQAAQQRSASQYFVLLLLTDGAV TDVEATCKAVVDASKLPMSVIIVGVGGADFEVMEQLDADGGPLRTRS
vWA-TerF-like |
 |
|---|
| PFAM accession number: | PF10138 |
|---|---|
| Interpro abstract (IPR019303): | vWA domain fused to TerD domain typified by the TerF protein [ (PUBMED:23044854) ]. Sometimes it is found as solos. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry vWA-TerF-like